PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009618932.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB
Protein Properties Length: 212aa    MW: 24559.3 Da    PI: 6.9769
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009618932.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding26.61.4e-082568344
                     SS-HHHHHHHHHHHHHTTTT...-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding  3 rWTteEdellvdavkqlGgg...tWktIartmgkgRtlkqcksrw 44
                      WT  Ed+l+ +a  ++  +   +W +Ia++++ g+t++++  ++
   XP_009618932.1 25 TWTRFEDKLFEQALVMYSENdveRWLKIANHVP-GKTAEDVMAHY 68
                     7********************************.********998 PP

2Myb_DNA-binding44.43.9e-14121165347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+ l++ +  ++G+g+W++I+r +  +Rt+ q+ s+ qky
   XP_009618932.1 121 PWTEEEHRLFLIGLDKYGKGDWRSISRNVVVTRTPTQVASHAQKY 165
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.08E-111971IPR009057Homeodomain-like
PROSITE profilePS512938.2292175IPR017884SANT domain
SMARTSM007173.7E-72274IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-52472IPR009057Homeodomain-like
CDDcd001671.62E-72568No hitNo description
PfamPF002496.4E-72568IPR001005SANT/Myb domain
PROSITE profilePS5129422.1114170IPR017930Myb domain
SuperFamilySSF466893.73E-17116171IPR009057Homeodomain-like
TIGRFAMsTIGR015577.2E-17117169IPR006447Myb domain, plants
SMARTSM007177.3E-11118168IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-11118164IPR009057Homeodomain-like
CDDcd001672.75E-9121165No hitNo description
PfamPF002494.3E-12121165IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 212 aa     Download sequence    Send to blast
MMYTTNNRWM IGSDSTATMI HSNSTWTRFE DKLFEQALVM YSENDVERWL KIANHVPGKT  60
AEDVMAHYDA LVHDVFEIDS GRVDPPSYPD DSFDWESDSK TSQISFGSNK KHEAERKKGT  120
PWTEEEHRLF LIGLDKYGKG DWRSISRNVV VTRTPTQVAS HAQKYYLRQQ SMKKERKRSS  180
IHDITTAVDT KTVPPQNSLQ NQGGYQNFNF PM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2cjj_A2e-1217100285RADIALIS
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00055PBMTransfer from AT5G04760Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0128560.0BT012856.1 Lycopersicon esculentum clone 113942F, mRNA sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009618932.11e-160PREDICTED: transcription factor DIVARICATA-like
RefseqXP_016459105.11e-160PREDICTED: transcription factor DIVARICATA-like
SwissprotQ8S9H75e-57DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLA0A0V0IMW71e-145A0A0V0IMW7_SOLCH; Putative transcription factor DIVARICATA-like
STRINGSolyc11g006720.1.11e-143(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA45472241
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G04760.16e-74MYB family protein